A practical reference on AOD9604: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-07-31. Anything still debated is marked as such rather than presented as settled.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Status varies by country; prohibited in sport. |
| Common storage temperature | 2–8 °C for lyophilized powder | Protect from light and moisture; follow supplier instructions. |
| Typical analytical method | LC-MS/MS | Used for identification and quantification in biological samples. |
| Purity assessment | HPLC and mass spectrometry | Reverse-phase HPLC is common for peptide purity. |
| Common synonyms | AOD9604; hGH 176-191 fragment | Naming conventions differ across studies. |
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Parasitoid use of viruses: parasitoid wasps lay their eggs inside host caterpillars; to keep the caterpillar's immune system from killing the egg, a virus is also "laid" with the eggs. Two unrelated wasps use this trick. Short-lived breeders: species that are in the juvenile phase for most of their lives. The adult lives are so short most do not have working mouth parts. Unrelated species: cicada, mayflies, some flies, dragonfly, silk moths, and some other moths. Katydids and frogs both make loud sounds with a sound-producing organs to attract females for mating. Camouflage of two kinds: twig-like camouflage independently in walking sticks and the larvae of some butterflies and moths; leaf camouflage is found independently in some praying mantises and winged moths. Dipteran flies and Strepsiptera insects independently came up with whirling drumsticks halteres that are used like gyroscopes in flight. Carcinisation: a crustacean evolves into a crab-like form from a non-crab-like form. The term was introduced into evolutionary biology by L. A. Borradaile, who described it as "one of the many attempts of Nature to evolve a crab".
Marshall (born 1944), American chemist, co-inventor of Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometry Archer John Porter Martin (1910–2002), British physical chemist, 1952 Nobel Prize in Chemistry for the invention of partition chromatography Martinus van Marum (1750–1837), Dutch physician, inventor, scientist and teacher, which created the "large electricity machine" Elmer McCollum (1879–1967), American biochemist, known for work of diet on health Edwin McMillan (1907–1991), American physicist, the first to produce a transuranium element, neptunium, 1951 Nobel Prize in Chemistry Lise Meitner (1878–1968), Austrian and Swedish nuclear physicist instrumental in the discovery of nuclear fission Dmitri Ivanovich Mendeleev (1834–1907), Russian chemist, creator of the Periodic table of elements Maud Menten (1879–1960). Canadian biochemist known for early work on enzyme kinetics John Mercer (1791–1866), British dye and fabric chemist who developed mercerisation, a process for treating cotton Robert Bruce Merrifield (1921–2006), solid-phase chemist, 1984 Nobel Prize in Chemistry Julius Lothar Meyer (1830–1895), German chemist, one of the pioneers in developing the earliest versions of the periodic table of the chemical elements Viktor Meyer (1848–1897), German organic and inorganic chemist, known for work on vapour densities
=== Inositol depletion hypothesis === Lithium treatment has been found to inhibit the enzyme inositol monophosphatase, involved in degrading inositol monophosphate to inositol required in PIP2 synthesis. This leads to lower levels of inositol triphosphate, created by decomposition of PIP2. This effect has been suggested to be further enhanced with an inositol triphosphate reuptake inhibitor. Inositol disruptions have been linked to memory impairment and depression. It is known with good certainty that signals from the receptors coupled to the phosphoinositide signal transduction are affected by lithium. Myo-inositol is also regulated by the high affinity sodium mI transport system (SMIT). Lithium is hypothesized to inhibit mI entering the cells and mitigate the function of SMIT. Reductions of cellular levels of myo-inositol results in the inhibition of the phosphoinositide cycle.
== Mechanism of action == Melanotan II acts as a non-selective agonist of the melanocortin receptors MC1, MC3, MC4, and MC5. Melanotan II produces melanogenesis by activation of the MC1 receptor, whereas its clinically documented sexual effects are thought to be related to its ability to activate the MC4 receptor (though the MC3 is thought to also possibly be involved). Melanotan II is partly metabolised into Bremelanotide, a medication used to treat low sexual desire. Other effects of melanotan II, mostly regarded as adverse effects, include flushing, nausea, vomiting, stretching, yawning, and loss of appetite (the last via activation of MC4).
Sources: en.wikipedia.org
homeodomain A nucleic acid-binding domain, typically 60 amino acids in length, found near the C-terminus of certain eukaryotic proteins, characterized by a highly conserved helix-turn-helix motif that binds with strong affinity to the backbone of specific recognition sequences in DNA or RNA molecules. A protein may have one or more homeodomains, each of which is specific to a different recognition sequence. Many homeodomain-containing proteins function as transcription factors by binding to sequences within promoters and blocking or recruiting other proteins, such as RNA polymerase or cofactors of the transcription initiation complex. Homeodomains are the translated versions of homeoboxes, though the terms are often used interchangeably.
== Scientific approach == In xenobiology, the aim is to design and construct biological systems that differ from their natural counterparts on one or more fundamental levels. Ideally these new-to-nature organisms would be different in every possible biochemical aspect exhibiting a very different genetic code. The long-term goal is to construct a cell that would store its genetic information not in DNA but in an alternative informational polymer consisting of xeno nucleic acids (XNA), different base pairs, using non-canonical amino acids and an altered genetic code. So far cells have been constructed that incorporate only one or two of these features.
=== Diagnostic tests === Once monoclonal antibodies for a given substance have been produced, they can be used to detect the presence of this substance. Proteins can be detected using the Western blot and immuno dot blot tests. In immunohistochemistry, monoclonal antibodies can be used to detect antigens in fixed tissue sections, and similarly, immunofluorescence can be used to detect a substance in either frozen tissue section or live cells.
Thyroxine, also known as tetraiodothyronine or T4, is a hormone produced by the thyroid gland. It is the primary form of thyroid hormone found in the blood and acts as a prohormone of the more active thyroid hormone, triiodothyronine (T3). Thyroxine and its active metabolites are essential for regulating metabolic rate, supporting heart and muscle function, promoting brain development, and maintaining bone health.
A problem that goes hand in hand with poverty in Mexico is the level of schooling. In the 1960s, when Mexican narcotic smugglers started to smuggle drugs on a major scale, only 5.6% of the Mexican population had more than six years of schooling. More recently, researchers from the World Economic Forum have noted that despite the Mexican economy ranking 31st out of 134 economies for investment in education (5.3% of its GDP), as of 2009, the nation's primary education system is ranked only 116th, thereby suggesting "that the problem is not how much but rather how resources are invested". The WEF further explained: "The powerful teachers union, the SNTE, the largest labor union in Latin America, has been largely responsible for blocking reforms that would increase the quality of spending and help ensure equal access to education." Teachers in the Acapulco region were "extorted, kidnapped, and intimidated" by cartels, including death threats demanding money. They went on strike in 2011.
Sources: en.wikipedia.org
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.
The World Anti-Doping Agency classifies growth hormone fragments, including AOD-9604, as prohibited substances. The classification reflects concern about potential performance-enhancing use. Athletes are subject to testing for such peptides.
Detection typically uses liquid chromatography combined with mass spectrometry. These methods separate the peptide and identify it by mass. Immunoassays may screen samples but require confirmation by a more specific technique.
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.