Everything below concerns regulatory status. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-07-21. Numbers and descriptions here follow the published literature rather than marketing material.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Fragment analog of human growth hormone |
| Sequence basis | hGH 176–191 region | Modified C-terminal fragment |
| Common synonyms | AOD-9604; AOD9604; hGH fragment | Research and trade names vary |
| Regulatory status | Not approved as a drug | Prohibited in competitive sport |
| Research code | AOD9604 | Used in scientific and patent literature |
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
There are no specialized neurons for the other three pheromones. Instead, these minor pheromones can cross-stimulate neurons, which is why partial blends that lack one or two of the minor pheromones can still fully stimulate the male receptors.
Voters consistently cited the economy as their top issue in the 2024 election. Following the COVID-19 pandemic, a global surge in inflation ensued that raised prices on many goods, although the U.S. inflation rate had declined significantly during 2023 and 2024. The New York Times reported that both candidates "embraced a vision of a powerful federal government, using its muscle to intervene in markets in pursuit of a stronger and more prosperous economy". The Wall Street Journal reported that economists found Trump's proposed policies created a greater risk of stoking inflation and generating higher budget deficits, relative to the Harris plan. Twenty-three Nobel Prize-winning economists signed a letter characterizing the Harris economic plan as "vastly superior" to the Trump plan. Trump's designated government efficiency leader Elon Musk said in October that he expected Trump's plan would involve more than $2 trillion in federal spending cuts and would cause "some temporary hardship." Harris ran on a pro-union platform. She promoted the passage of the Infrastructure Investment and Jobs Act, funding for small business, and previously supported an act as senator to provide a $6,000 tax credit for middle and low-income families. Harris promised to address price gouging, bring down costs, ban hidden fees and late charges from financial institutions, limit "unfair" rent increases and cap prescription drug costs, which she said would "lower costs and save many middle-class families thousands of dollars a year".
=== EC 1.17.1 With NAD or NADP as acceptor === EC 1.17.1.1: CDP-4-dehydro-6-deoxyglucose reductase EC 1.17.1.2: now classified as EC 1.17.7.4, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC 1.17.1.3: leucoanthocyanidin reductase EC 1.17.1.4: xanthine dehydrogenase EC 1.17.1.5: nicotinate dehydrogenase EC 1.17.1.6: Now EC 1.17.99.5, bile-acid 7α-dehydroxylase. It is now known that FAD is the acceptor and not NAD+ as was thought previously EC 1.17.1.7: Now EC 1.2.1.91, 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase EC 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase EC 1.17.1.9: formate dehydrogenase EC 1.17.1.10: formate dehydrogenase (NADP+) EC 1.17.1.11: formate dehydrogenase (NAD+, ferredoxin)
The top-down approach is breaking down of a system into small components, while bottom-up is assembling sub-systems into a larger system. A bottom-up approach for nano-assembly is a primary research target for nano-fabrication because top down synthesis is expensive (requiring external work) and is not selective on very small length scales, but is currently the primary mode of industrial fabrication. Generally, the maximum resolution of the top-down products is much coarser than those of bottom-up; therefore, an accessible strategy to bridge "bottom-up" and "top-down", is realizable by the principles of self-assembly. By controlling local intermolecular forces to find the lowest-energy configuration, self-assembly can be guided by templates to generate similar structures to those currently fabricated by top-down approaches. This so-called bridging will enable fabrication of materials with the fine resolution of bottom-up methods and the larger range and arbitrary structure of top-down processes. Furthermore, in some cases components are too small for top-down synthesis, so self-assembly principles are required to realize these novel structures. Classification Nanostructures can be organized into groups based on their size, function, and structure; this organization is useful to define the potential of the field. By size Among the more sophisticated and structurally complex nanostructures currently available are organic macromolecules, wherein their assembly relies on the placement of atoms into molecular or extended structures with atomic-level precision.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
==== Formation of the neurotransmitter gamma-aminobutyric acid ==== A study conducted on the GABAergic neurons (i.e., nerve cells) in the neocortex of rat brains reported that the cytosolic form of the aspartate transaminase enzyme metabolizes α-ketoglutarate to glutamate which in turn is metabolized by glutamic acid decarboxylase to the inhibitory neurotransmitter gamma-aminobutyric acid. These metabolic reactions occur at the ends of the inhibitory axons of the GABAergic neurons and result in the release of gamma-aminobutyric acid which then inhibits the activation of nearby neurons.
Pluralism and regulation of the media, such as through 'the licensing of broadcasting, television or cinema enterprises', have long been seen as essential to protect freedom of opinion and expression, to ensure that citizens have a more equal voice, and ultimately to support the universal 'right to take part in the government'. In almost all member states there is a well funded public, and independent broadcaster for TV and radio, and there are common standards for all TV and radio, which are designed to support open, fact-based discussion and deliberative democracy. However, the same standards have not yet been applied to equivalent internet television, radio or "social media" such as the platforms controlled by YouTube (owned by Alphabet), Facebook or Instagram (owned by Meta), or Twitter (owned by Elon Musk), all of which have spread conspiracy theories, discrimination, far-right, extremist, terrorist, and hostile military content.
Although these patients were historically classified as having DM, they are now generally considered to have the distinct clinical entity antisynthetase syndrome, even in the presence of characteristic cutaneous features. Magnetic resonance imaging may be useful for guiding muscle biopsy and for distinguishing active inflammation from irreversible muscle damage as contributors to muscle weakness. In addition to muscle inflammation, MRI frequently demonstrates fascial inflammation (fasciitis) in patients with DM. X-ray may be used to investigate joint involvement and calcifications. A case of DM may be classified as clinically amyopathic dermatomyositis (CADM) when cutaneous manifestations predominate and there is little or no clinical evidence of muscle involvement. Anti-MDA5 autoantibodies are strongly associated with CADM and are frequently accompanied by rapidly progressive interstitial lung disease. Patients with anti-TIF1-γ autoantibodies also commonly present with clinically amyopathic disease, although less frequently than those with anti-MDA5 autoantibodies. Juvenile dermatomyositis (JDM) has traditionally been regarded as a distinct entity from adult-onset DM. However, there is no convincing evidence that the two differ fundamentally in their pathophysiology, and they are now generally considered age-specific presentations of the same group of conditions.
== External links == "The Science of Drug Use: A Resource for the Justice Sector". www.drugabuse.gov. North Bethesda, Maryland: National Institute on Drug Abuse. 26 May 2020. Retrieved 23 December 2021. School-Based Drug Abuse Prevention: Promising and Successful Programs (PDF). Ottawa, Ontario: Public Safety Canada. 31 January 2018. ISBN 978-1-100-12181-9. Archived (PDF) from the original on 19 May 2021. Retrieved 23 December 2021. {{cite book}}: |website= ignored (help) Sacco LN, Finklea K (3 May 2016). "Synthetic Drugs: Overview and Issues for Congress" (PDF). Washington, D.C.: Congressional Research Service. Archived (PDF) from the original on 8 December 2021. Retrieved 23 December 2021.
== Description == There is no mention of the Korean People's Revolutionary Army in documents written by Kim Il Sung himself during his time in the Soviet Army. Coined in the wake of the May 25th Instructions, the purported army is connected to Kim Il Sung's cult of personality initiated by the guerrilla faction from the Soviet Army's 88th Separate Rifle Brigade, which seized power in North Korea. The KPRA was first mentioned in the late 1940s. Korean People's Revolutionary Army was allegedly founded on 25 April 1932. North Korean historiography credits the defeat of Japan in 1945 mostly to the KPRA, downplaying Soviet involvement. From 1978, North Korea marked 25 April as the "true" founding date of the Korean People's Army (KPA), with the KPA being claimed to just be the reconstitution of the KPRA. North Korean leader Kim Jong Un moved back the KPA's official founding date back to its original date of 8 February 1948, with 25 April instead becoming the official foundation date of the KPRA
Sources: en.wikipedia.org
The lattice energy is the summation of the interaction of all sites with all other sites. For unpolarizable spherical ions, only the charges and distances are required to determine the electrostatic interaction energy. For any particular ideal crystal structure, all distances are geometrically related to the smallest internuclear distance. So for each possible crystal structure, the total electrostatic energy can be related to the electrostatic energy of unit charges at the nearest neighboring distance by a multiplicative constant called the Madelung constant that can be efficiently computed using an Ewald sum. When a reasonable form is assumed for the additional repulsive energy, the total lattice energy can be modelled using the Born–Landé equation, the Born–Mayer equation, or in the absence of structural information, the Kapustinskii equation. Using an even simpler approximation of the ions as impenetrable hard spheres, the arrangement of anions in these systems are often related to close-packed arrangements of spheres, with the cations occupying tetrahedral or octahedral interstices. Depending on the stoichiometry of the salt, and the coordination (principally determined by the radius ratio) of cations and anions, a variety of structures are commonly observed, and theoretically rationalized by Pauling's rules.
== Computer database analysis == The peak list obtained through spectrometric means is used as the query in a database search using the software MASCOT. The MASCOT software uses an algorithm that looks for significant peptide sequence homology to present the most statistically likely protein in the sample, based on the results. In performing the search, you much choose a database to go through. Such databases include, among others, Swissprot, often used when researching well characterized organisms like humans, mice, and yeasts; and NCBInr for more general, robust searches. A detailed tutorial on using MASCOT software can be found in a link below.
Bare lymphocyte syndrome Chronic granulomatous disease (Bridges–Good syndrome, chronic granulomatous disorder, Quie syndrome) Common variable immunodeficiency (acquired hypogammaglobulinemia) Complement deficiency DiGeorge syndrome (DiGeorge anomaly, thymic hypoplasia) Graft-versus-host disease Griscelli syndrome Hyper-IgE syndrome (Buckley syndrome, Job syndrome) Immunodeficiency with hyper-IgM Immunodeficiency–centromeric instability–facial anomalies syndrome (ICF syndrome) Isolated IgA deficiency Isolated primary IgM deficiency Janus kinase 3 deficiency Leukocyte adhesion molecule deficiency LIG4 syndrome Myeloperoxidase deficiency Neutrophil immunodeficiency syndrome Nezelof syndrome (thymic dysplasia with normal immunoglobulins) Omenn syndrome Purine nucleoside phosphorylase deficiency Severe combined immunodeficiency (alymphocytosis, Glanzmann–Riniker syndrome, severe mixed immunodeficiency syndrome, thymic alymphoplasia) Shwachman–Bodian–Diamond syndrome Thymoma with immunodeficiency (Good syndrome) Transient hypogammaglobulinemia of infancy Warts–hypogammaglobulinemia–infections–myelokathexis syndrome (WHIM syndrome) Wiskott–Aldrich syndrome X-linked agammaglobulinemia (Bruton syndrome, sex-linked agammaglobulinemia) X-linked hyper-IgM syndrome X-linked hypogammaglobulinemia X-linked lymphoproliferative disease (Duncan's disease) X-linked neutropenia
A 2023 systematic review and meta-analysis of 75 studies, covering 55,761 men across data collected between 1942 and 2021, found that average erect penis length increased by approximately 24% over the past 29 years globally, across all age groups and geographic regions. The authors noted that this rapid rate of change, too fast to be explained by genetic drift alone, points toward environmental or lifestyle factors as likely contributors. They drew a parallel with concurrent trends in male reproductive health, including declining sperm counts and testosterone levels and rising rates of genital birth defects such as hypospadias, which have similarly been attributed to environmental exposures. Specific hypothesized mechanisms include increased prenatal and postnatal exposure to endocrine-disrupting chemicals, as well as earlier onset of puberty, itself potentially linked to sedentary lifestyles or hormonal disruption.
Sources: en.wikipedia.org
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.
It was investigated in clinical trials for obesity, but it did not receive approval for that use in major markets. Results were generally modest or mixed, and it remains an experimental compound.
WADA lists it as a prohibited peptide hormone. Its use can be detected by laboratory methods, and athletes are subject to sanctions if it is found in samples.
It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.